Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP
| Product name: | Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant E.coli Methionine Aminopeptidase is produced by our E.coli expression system and the target gene encoding Ala2-Glu264 is expressed with a 6His tag at the C-terminus. |
| Names | Methionine Aminopeptidase, MAP, Peptidase M, map |
| Accession # | P0AE18 |
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYP KSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQE SLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLK PGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS HDELEHHHHHH
|
| Background | Methionine Aminopeptidase (MAP) is a member of the peptidase M24A family. MAP is essential for cell growth because it plays a central role for protein maturation as it removes the initiator Met residue from newly synthesized proteins. |












