Recombinant E. coli Formamidopyrimidine-DNA Glycosylase/Fpg

Instruction Manual!

Product name:	Recombinant E. coli Formamidopyrimidine-DNA Glycosylase/Fpg
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM EDTA, 1mM DTT, 50% Glycerol, pH 7.8.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant E.coli Fpg is produced by our E.coli expression system and the target gene encoding Met1-Lys269 is expressed with a 6His tag at the C-terminus.
Names	Formamidopyrimidine-DNA Glycosylase, Fapy-DNA Glycosylase, DNA-(Apurinic or Apyrimidinic Site) Lyase MutM, AP Lyase MutM, mutM, fpg
Accession #	A7ZTI6
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM EDTA, 1mM DTT, 50% Glycerol, pH 7.8.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLLLELPE GWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTKELEGHNVLTHLG PEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLASSLSLAEC ELLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIVATKHAQRA TFYCRQCQKLEHHHHHH
Background	Fpg is a DNA glycosylase that releases damaged bases preferentially from duplex DNA. It has an associated class I AP (apurinic/apyrimidinic) lyase activity.Fpg Cleaves the DNA backbone to generate a single-strand break at the site of the removed base, The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving 3' and 5' phosphoryl groups.