Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4/UBE2D4
| Product name: | Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4/UBE2D4 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| ource | E.coli |
| Description | Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4 is produced by our E.coli expression system and the target gene encoding Met1-Met147 is expressed with a GST tag at the N-terminus. |
| Names | Ubiquitin-Conjugating Enzyme E2 D4, HBUCE1, Ubiquitin Carrier Protein D4, Ubiquitin-Protein Ligase D4, UBE2D4, UBCH5D |
| Accession # | Q9Y2X8 |
| Formulation | Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMALKRIQKELTDLQRDPPAQCSAGPVGDDL FHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSP ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
|
| Background | Ubiquitin-Conjugating Enzyme E2 D4 (UBE2D4) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2D4 has been proposed to participate in Ubl conjugation pathway. UBE2D4 takes part in post-translational protein modification, protein K6-linked ubiquitination, protein K11-linked ubiquitination, protein K27-linked ubiquitination, protein K29-linked ubiquitination, protein K48-linked ubiquitination, and protein K63-linked ubiquitination. UBE2D4 regulate of protein metabolic process. UBE2D4 accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2D4 able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked poly-ubiquitination. |












