Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK

Instruction Manual!

Product name:	Recombinant E. coli N-Acetyl-D-Glucosamine Kinase/NAGK
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl,2mM DTT,20% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant E.coli N-acetyl-D-Glucosamine Kinase is produced by our E.coli expression system and the target gene encoding Met1-Asp303 is expressed with a 6His tag at the C-terminus.
Names	N-Acetyl-D-Glucosamine Kinase; N-Acetylglucosamine Kinase; GlcNAc Kinase; NAGK
Accession #	P75959
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl,2mM DTT,20% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRF GCKGSVGIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEF TQYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCGQHGC IENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNILTIVDPDLV VIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLHLTD
Background	N-Acetyl-D-Glucosamine Kinase (NAGK) belongs to the Eukaryotic-Type N-Acetylhexosamine Kinases family. NAGK is a homodimer and expressed in many tissues. NAGK is a prominent salvage enzyme of amino sugar metabolism in mammals. It is a major component of complex carbohydrates and converts GlcNAc into GlcNAc 6-phosphate from lysosomal degradation or nutritional sources. In addition, NAGK has ManNAc kinase activity.