Recombinant Human N-Acyl-Aromatic-L-Amino Acid Amidohydrolase/ACY3 (N-6His)
Product name: | Recombinant Human N-Acyl-Aromatic-L-Amino Acid Amidohydrolase/ACY3 (N-6His) |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,1mM DTT,10%Glycerol,pH 8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E.coli |
Description | Recombinant Human Aminoacylase-3 is produced by our E.coli expression system and the target gene encoding Met1-Ser319 is expressed with a 6His tag at the N-terminus. |
Names | N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming),ACY3,Acylase III,Aminoacylase-3,ACY-3,Aspartoacylase-2,Hepatitis C virus core-binding protein 1,HCBP1,HCV core-binding protein 1,ASPA2,ACY3 |
Accession # | Q96HD9 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,1mM DTT,10%Glycerol,pH 8.0. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRAS FSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFD FVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGL GLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLA GTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEKFTFTV PAMPALTPAPSPAS
|
Background | Aspartoacylase 3, also known as ACY3, N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming), Acylase III, Aminoacylase-3, Aspartoacylase-2, Aspartoacylase-2, HCV core-binding protein 1 and ASPA2, is a member of the Aspartoacylase subfamily. ACY3 plays an important role in deacetylating mercapturic acids in kidney proximal tubules and acts on N-acetyl-aromatic amino acids.ACY3 is located in the cytoplasm of S2 and S3 proximal tubules and the apical domain of S1 proximal tubules. ACY3 protein is also expressed at low levels in stomach, testis, heart, brain, lung and liver, and may function as an HCV (Hepatitis C virus) core binding protein. |