Recombinant Mouse Syndecan-Binding Protein 1/Syntenin-1/SDCBP
| Product name: | Recombinant Mouse Syndecan-Binding Protein 1/Syntenin-1/SDCBP |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Mouse Syntenin-1 is produced by our E.coli expression system and the target gene encoding Ser2-Val299 is expressed with a 6His tag at the C-terminus. |
| Names | Syntenin-1,Scaffold protein Pbp1,Syndecan-binding protein 1,Sdcbp |
| Accession # | O08992 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEA EICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRL KSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRP FERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILS TAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEVLEHHHHHH
|
| Background | SDCBP, also called syntenin-1, is short for Syndecan-binding protein 1. It is expressed by the gene Sdcbp. SDCBP seems to function as an adapter protein. In adherens junctions, the protein may function to couple syndecans to cytoskeletal proteins or signaling components. Meanwhile it seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA). SDCBP also play a role in vesicular trafficking, and is required for the targeting of TGFA to the cell surface in the early secretory pathway. |












