Recombinant Mouse Testican-3/SPOCK3
| Product name: | Recombinant Mouse Testican-3/SPOCK3 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Mouse Testican-3 is produced by our Mammalian expression system and the target gene encoding Ala23-Ile436 is expressed with a 6His tag at the C-terminus. |
| Names | Testican-3,Spock3 |
| Accession # | Q8BKV0-1 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
AAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNKFRDEVEDDYFRTWNPGKPFDQALDPAK DPCLKTKCSRHKVCITQDAQTALCISHRRLTHSMKEVGGSHKQWRGLPSSTCKPCPIAYASPVCG SDGHSYSSQCKLEYQACVLGKQISIKCEGRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWF KALHESGSQNKKTKALLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKNE QCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCHTELSNIQKRQGIKKLLGQYIPLCDEDGYY KPTQCHGSVGQCWCVDRYGNEVVGSRINGVADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDK DDIEDDDEDEGDDDDDGDVHDGYIVDHHHHHH
|
| Background | SPOCK3,also called Testican3,is a secreted protein and make up a family of extracellular heparan/chondroitin sulfate proteoglycans. It contains 1 Kazal-like domain and 1 thyroglobulin type-1 domain and mainly expressed in brain. SPOCK3 contain inhibitory regions in several domains targeted to different classes of protease, and in some cases may act as protease inhibitors. In addition to their presence in testis, testicans are enriched in brain and have been shown to regulate neuronal attachment and outgrowth. |












