Recombinant Human HAI-2/KOP/SPINT2

Instruction Manual!

Product name:	Recombinant Human HAI-2/KOP/SPINT2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Hepatocyte Growth Factor Activator Inhibitor Type 2 is produced by our Mammalian expression system and the target gene encoding Ala28-Lys197 is expressed with a 6His tag at the C-terminus.
Names	Kunitz-Type Protease Inhibitor 2, Hepatocyte Growth Factor Activator Inhibitor Type 2, HAI-2, Placental Bikunin, SPINT2, HAI2, KOP
Accession #	O43291
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVT ENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNS CNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVDHHHHHH
Background	Hepatocyte Growth Factor Activator Inhibitor Type 2 (HAI2) is a single-pass type I membrane protein and contains two BPTI/Kunitz inhibitor domains. The first Kunitz domain is mainly responsible for the inhibitory activity against hepatocyte growth factor activator (HGFA). HAI2 is expressed in placenta, kidney, pancreas, prostate, testis, thymus and trachea. HAI2 serves as a inhibitor of HGF activator. It also inhibits plasmin, plasma and tissue kallikrein and factor XIa. Defects in HAI2 are the cause of diarrhea type 3 (DIAR3), also known as congenital sodium diarrhea (CSD).
References	N-Glycan Branching Affects the Subcellular Distribution of and Inhibition of Matriptase by HAI-2/Placental Bikunin