Recombinant Human Butyrylcholine Esterase/BCHE

Instruction Manual!

Product name:	Recombinant Human Butyrylcholine Esterase/BCHE
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Butyrylcholine Esterase is produced by our Mammalian expression system and the target gene encoding Glu29-Leu602 is expressed with a 6His tag at the C-terminus.
Names	Cholinesterase, Acylcholine Acylhydrolase, Butyrylcholine Esterase, Choline Esterase II, Pseudocholinesterase, BCHE, CHE1
Accession #	P06276
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSC CQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDG KFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLF GESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEI IKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDE GTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALG DVVGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDN YTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCR FWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGLVDHHHHHH
Background	Butyrylcholine Esterase (BCHE) is a secreted protein that belongs to the type-B carboxylesterase/lipase family. BCHE is a major acetylcholine hydrolyzing enzyme in the circulation. It is detected in blood plasma and present in most cells except erythrocytes. BCHE is an esterase with broad substrate specificity. BCHE can contribute to the inactivation of the neurotransmitter acetylcholine. BCHE can degrade a large number of neurotoxic organophosphate esters. Thus, it plays important pharmacological and toxicological roles and is thought to be involved in the pathological progression. Defects in BCHE are the cause of butyrylcholinesterase deficiency (BChE deficiency) which is a metabolic disorder characterized by prolonged apnoea after the use of certain anesthetic drugs, including the muscle relaxants succinylcholine and other ester local anesthetics.