elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Protein Phosphatase 1 Regulatory Subunit 1A/PPP1R1A

Recombinant Human Protein Phosphatase 1 Regulatory Subunit 1A/PPP1R1A Recombinant Human Protein Phosphatase 1 Regulatory Subunit 1A/PPP1R1A

Instruction Manual!

Product name: Recombinant Human Protein Phosphatase 1 Regulatory Subunit 1A/PPP1R1A
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, 50% Glycerol, pH 8.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human PPP1R1A is produced by our E.coli expression system and the target gene encoding Met1-Val171 is expressed with a 6His tag at the C-terminus.
Names Protein Phosphatase 1 Regulatory Subunit 1A, Protein Phosphatase Inhibitor 1, I-1, IPP-1, PPP1R1A, IPP1
Accession # Q13522
Formulation Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM DTT, 50% Glycerol, pH 8.5.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLA MSPRQRKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTS GTAKKTAECIPKTHERGSKEPSTKEPSTHIPPLDSKGANSVLEHHHHHH
Background Protein Phosphatase 1 Regulatory Subunit 1A (PPP1R1A) is an inhibitor of protein-phosphatase 1. PPP1R1A is a cellular regulator of eIF2 alpha phosphorylation. In hormonal control of glycogen metabolism, IPP-1 protein plays important function. Hormones can elevate intracellular cAMP level and elevate IPP-1 activity. PPP1R1A activation caused cAMP increase , cAMP control over proteins that are not directly phosphorylated by PKA following a rise in intracellular calcium. IPP-1 is inactivated by calcineurin (PP2B). Multiple domains in IPP-1 target cellular PP1 complexes.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese