Recombinant Human Protein Phosphatase 1 Regulatory Subunit 14A/PPP1R14A

Instruction Manual!

Product name:	Recombinant Human Protein Phosphatase 1 Regulatory Subunit 14A/PPP1R14A
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 0.2mM EDTA, 1mM DTT, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PPP1R14A is produced by our E.coli expression system and the target gene encoding Met1-Pro147 is expressed with a 6His tag at the C-terminus.
Names	Protein Phosphatase 1 Regulatory Subunit 14A, 17 kDa PKC-Potentiated Inhibitory Protein of PP1, Protein Kinase C-Potentiated Inhibitor Protein of 17 kDa, CPI-17, PPP1R14A, CPI17, PPP1INL
Accession #	Q96A00
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 0.2mM EDTA, 1mM DTT, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYR GMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPS HDGSLSPLQDRARTAHPLEHHHHHH
Background	Protein Phosphatase 1 Regulatory Subunit 14A (PPP1R14A) belongs to the PP1 inhibitor family. PPP1R14A is mapped to chromosome 19q13.13-q13.2. PPP1R14A binds directly to protein kinase C and casein kinase I. Meantime, PPP1R14A is a phosphorylation-dependent inhibitor of smooth muscle myosin phosphatase. PPP1R14A is the inhibitor of PPP1CA. When phosphorylated, PPP1R14A has over 1000-fold higher inhibitory activity, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction. In addition, inhibition of PPP1R14A also enhances contraction of smooth muscle in the absence of increment of intracellular Ca2+ concentration.