Recombinant Human Uroplakin-2/UPK2

Instruction Manual!

Product name:	Recombinant Human Uroplakin-2/UPK2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Uroplakin-2 is produced by our Mammalian expression system and the target gene encoding Asp26-Gly155 is expressed with a 6His tag at the C-terminus.
Names	Uroplakin-2, UP2, Uroplakin II, UPII, UPK2
Accession #	O00526
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVSVV DSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPRRNMESIGLGMARTGG VDHHHHHH
Background	Uroplakin-2 is a single-pass type I membrane protein that belongs to the uroplakin-2 family. Uroplakin-2 is a component of the asymmetric unit membrane (AUM) and expressed in the ureter, a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. Uroplakin-2 forms heterodimer with UPK1A that is necessary for exiting out of the endoplasmic reticulum (ER). Uroplakin-2 may play an important role in regulating the assembly of the AUM. AUM is believed to strengthen the urothelium by preventing cell rupture during bladder distention.