Recombinant Human Interferon Regulatory Factor 5/IRF5

Instruction Manual!

Product name:	Recombinant Human Interferon Regulatory Factor 5/IRF5
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Interferon Regulatory Factor 5 is produced by our E.coli expression system and the target gene encoding Met1-Gln498 is expressed with a 6His tag at the C-terminus.
Names	Interferon Regulatory Factor 5, IRF-5, IRF5
Accession #	Q13568
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFK AWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDS QPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAP DPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRP PRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGL ILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTP PPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMV EQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQLEHHHHHH
Background	Interferon Regulatory Factor 5 (IRF5) is a member of the IRF family. It contains one IRF tryptophan pentad repeat DNA-binding domain. IRF5 shuttles between the nucleus and the cytoplasm. IRF5 can form homodimer when it is phosphorylated. IRF5 functions as a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Genetic variations in IRF5 are associated with susceptibility to systemic lupus erythematosus type 10. In addition, the genetic variations wil result in susceptibility to rheumatoid arthritis.