Recombinant Human 6-O-Methylguanine-DNA Methyltransferase/MGMT

Instruction Manual!

Product name:	Recombinant Human 6-O-Methylguanine-DNA Methyltransferase/MGMT
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mMTrisHCl,1mM EDTA, pH 8.0 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human MGMT is produced by our E.coli expression system and the target gene encoding Met1-Asn207 is expressed with a 6His tag at the N-terminus.
Names	Methylated-DNA--protein-cysteine methyltransferase, 6-O-methylguanine-DNAmethyltransferase,O-6-methylguanine-DNA-alkyltransferase, MGMT
Accession #	P16455
Formulation	Supplied as a 0.2 μm filtered solution of 20mMTrisHCl,1mM EDTA, pH 8.0 .
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVE VPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGE VISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHR LGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Background	MGMT belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. MGMT involved in the cellular defense against the biological effects of O6-methylguanine in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. MGMT catalyzes the chemical reaction: DNA (containing 6-O-methylguanine) and proteinL-cysteine into DNA (without 6-O-methylguanine) and protein S-methyl-L-cysteine.