Recombinant Human Apolipoprotein C-II/APOC2

Instruction Manual!

Product name:	Recombinant Human Apolipoprotein C-II/APOC2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mMPB,150mM NaCL,30%glycerol,pH7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Apolipoprotein C-II is produced by our E.coli expression system and the target gene encoding Met1-Glu82 is expressed with a 6His tag at the C-terminus.
Names	Apolipoprotein C-II, Apolipoprotein C2, APC2 and APOC2
Accession #	P02655
Formulation	Supplied as a 0.2 μm filtered solution of 20mMPB,150mM NaCL,30%glycerol,pH7.2.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYT GIFTDQVLSVLKGEELEHHHHHH
Background	APOC2 activates the lipoprotein lipase in capillaries, which hydrolyzes triglycerides and thus provides free fatty acids for cells. APOC2 is component of the very low density lipoprotein (VLDL) fraction in plasma. It is also an activator of several triacylglycerol lipases. The association of APOC2 with plasma chylomicrons, VLDL, and HDL is reversible, a function of the secretion and catabolism of triglyceride-rich lipoproteins, and changes rapidly. Defects in APOC2 are the cause of hyperlipoproteinemia type 1B (HLPP1B) which characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis.