Recombinant Human Trypsin 1/TRP1/TRY1/TRYP1/PRSS1

Instruction Manual!

Product name:	Recombinant Human Trypsin 1/TRP1/TRY1/TRYP1/PRSS1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Trypsin 1 is produced by our Mammalian expression system and the target gene encoding Ala16-Ser247 is expressed with a Fc, 6His tag at the C-terminus.
Names	Trypsin-1,Beta-trypsin, Cationic trypsinogen, Serine protease 1, Trypsin I, TRP1, TRY1, TRY4, TRYP1,PRSS1,
Accession #	P07477
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEV LEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWG NTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQL QGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANSVDDIEGRMDEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGKHHHHHH
Background	Trypsin-1, also known as Beta-trypsin, Cationic trypsinogen, Serine protease 1, Trypsin I, TRP1, TRY1, TRY4, TRYP1 and PRSS1, is a member of the trypsin family of serine proteases. PRSS1 contains one peptidase S1 domain and binds one calcium ion per subunit. PRSS1 is secreted by the pancreas and cleaved to its active form in the small intestine. Trypsin-1 is active on peptide linkages involving the carboxyl group of lysine or arginine. Defects in PRSS1 are a cause of pancreatitis (PCTT), which characterized by the presence of calculi in pancreatic ducts.