Recombinant Human Electron Transfer Flavoprotein Subunit β/ETFB

Instruction Manual!

Product name:	Recombinant Human Electron Transfer Flavoprotein Subunit β/ETFB
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human ETFB is produced by our E.coli expression system and the target gene encoding Met1-Ile255 is expressed with a 6His tag at the N-terminus.
Names	Electron-transfer-flavoprotein beta polypeptide, MADD, beta-ETF.
Accession #	P38117
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MNHKVHHHHHHMAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKE KKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDL VLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTAD LRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKL KEIGRI
Background	Electron transfer flavoprotein subunit beta is a subunit of electron transfer flavoprotein, serves as a specific electron acceptor for several dehydrogenases. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase). Electron transfer flavoprotein subunit beta and alpha combine a heterodimer can binds 1 FAD per dimer. Defects in ETFB are the cause of glutaric aciduria type 2B (GA2B).