Recombinant Human Sentrin-Specific Protease 2/SENP2

Instruction Manual!

Product name:	Recombinant Human Sentrin-Specific Protease 2/SENP2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES,5% Glycerol, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Sentrin-specific protease 2 is produced by our E.coli expression system and the target gene encoding Asp363-Leu589 is expressed.
Names	Sentrin-specific protease 2; Axam2; SMT3-specific isopeptidase 2; Sentrin/SUMO-specific protease SENP2; KIAA1331; SENP2.
Accession #	Q9HC62
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES,5% Glycerol, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERN KKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLK YLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYAD YISRDKPITFTQHQMPLFRKKMVWEILHQQLL
Background	SENP2 is an enzyme that belongs to the peptidase C48 family. SENP2 is a protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. It has been implicated as a down-regulator of CTNNB1 levels and may therefore be a modulator of the Wnt pathway.