| ELISA kit |
| Clinical diagnosis |
| Trfia |
| ANTIBODIES |
| CLIA kits |
| Proteins |
| New Products |
| > Human |
| > Canine |
| > Bovine |
| > Equine |
| > Fish |
| > Mouse |
| > Rat |
| > Chicken |
| > Porcine |
| > Rabbit |
| > Goat |
| > Simian |
| > General |
| > Cavia |
| > Caprine |
| > Sheep |
| > Cattle |
Recombinant Human Progonadoliberin-2/GNRH2
Instruction Manual!
| Product name: | Recombinant Human Progonadoliberin-2/GNRH2 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
SourceHuman CellsDescriptionRecombinant Human Progonadoliberin-2 is produced by our Mammalian expression system and the target gene encoding Gln24-Val120 is expressed with a 6His tag at the C-terminus.NamesProgonadoliberin-2, Progonadoliberin II, Gonadoliberin-2, Gonadoliberin II, Gonadotropin-Releasing Hormone II, GnRH II, Luliberin II, Luteinizing Hormone-Releasing Hormone II, LH-RH II, GnRH-Associated Peptide 2, GnRH-Associated Peptide II, GNRH2Accession #O43555FormulationLyophilized from a 0.2 μm filtered solution of PBS,PH7.4.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALAPLDDSMPWEGRTT AQWSLHRKRHLARTLLTAAREPRPAPPSSNKVVDHHHHHH
BackgroundProgonadoliberin-2, also known as Progonadoliberin II and GNRH2, belongs to the gonadotropin-releasing hormone family. GNRH2 is specially expressed in midbrain, at significantly higher levels outside the brain (up to 30-fold). GNRH2 can be cleaved into two chains, gonadoliberin-2 and GnRH-associated peptide 2. gonadoliberin-2 regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. The proproteins produce three transcript variants, but produce the same peptide hormone.
