ecombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12
| Product name: | ecombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus. |
| Names | Secreted and Transmembrane Protein 1, Protein K-12, SECTM1, K12 |
| Accession # | Q8WVN6 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQL QVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH
|
| Background | Secreted and Transmembrane Protein 1 (SECTM1) is a transmembrane and secreted protein that belongs to the SECTM family. SECTM1 is expressed in a perinuclear Golgi-like pattern. It is detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. SECTM1 is considered to participate in thymocyte signaling and the hematopoietic/immune system processes. It is reported that SECTM1 is a broadly expressed, IFN-γ-inducible molecule, which functions as a potent costimulatory ligand for T cell activation and is synergistic with anti-CD28. |












