Recombinant Human Platelet-derived Growth Factor Receptor Alpha/PDGF Rα
| Product name: | Recombinant Human Platelet-derived Growth Factor Receptor Alpha/PDGF Rα |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Platelet-derived Growth Factor Receptor Alpha is produced by our Mammalian expression system and the target gene encoding Gln24-Glu524 is expressed with a 6His at the C-terminus. |
| Names | Platelet-derived growth factor receptor alpha; PDGFR-alpha; Alpha platelet-derived growth factor receptor;CD140 antigen-like family member A; Platelet-derived growth factor alpha receptor; Platelet-derived growth factor receptor 2; PDGFR-2; CD140a |
| Accession # | P16234 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
QLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVS SASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTT DPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEM EALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVK DSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRIS WLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQV PSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHS RDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSEHHHHHH
|
| Background | Platelet-derived Growth Factor Receptor Alpha (PDGF Rα) is an enzyme that belongs to the class III subfamily of receptor tyrosine kinases.It is a type I transmembrane glycoprotein, and can form homo- or hetero-dimeric receptors when engaged by dimers of the PDGF family of growth factors, PDGF Rα is strongly expressed in oligodendrocyte, lung, skin and intestinal progenitor cells and induced by inflammation or growth in culture, but is lowly expressed in most mesenchymal cells. PDGF Rα autophosphorylates upon dimerization, activating signaling cascades in PI-3kinase Ras-MAP kinase, and PLC-γ pathways. PDGF Rα has infulence on local gradients of epithelially produced PDGF-AA or PDGF-CC during formation of the cranial ,cardiac neural crest and interstitial kidney mesenchyme. |












