Recombinant Human Bone Morphogenetic Protein 7
| Product name: | Recombinant Human Bone Morphogenetic Protein 7 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 4mM HCl. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Bone Morphogenetic Protein 7 is produced by our Mammalian expression system and the target gene encoding Ser293-His431 is expressed. |
| Names | Bone morphogenetic protein 7; BMP-7; Osteogenic protein 1; OP-1; Bmp7; Eptotermin alfa |
| Accession # | P18075 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 4mM HCl. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRN MVVRACGCH
|
| Background | Bone morphogenetic protein 7 (BMP-7) is a widely expressed TGF-β superfamily member with important functions during embryogenesis, in the adult, and in disease. The BMP-7 propeptide is cleaved intracellularly but remains in association with the growth factor domain. BMP-7 is subsequently secreted as a tetramer that consists of two propeptides and two disulfide-linked growth factor domains. Mature BMP-7 can also form disulfide-linked heterodimers with BMP-2 or BMP-4, complexes that show increased potency and range of activity compared to BMP-7 homodimers. BMP-7 exerts its biological effects through the type 2 receptors Activin RIIA, Activin RIIB, and BMPR-II and the type 1 receptors Activin RIA, BMPR-IA, and BMPR-IB. BMP-7 plays a role in a variety of organ systems. It promotes new bone formation and nephron development, inhibits the branching of prostate epithelium, and antagonizes epithelial-mesenchymal transition (EMT). In pathological conditions, BMP-7 inhibits tumor growth and metastasis, ameliorates fibrotic damage in nephritis, and promotes neuroregeneration following brain ischemia. |












