Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2
| Product name: | Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Greater than 95% as determined by reducing SDS-PAGE. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Human Aldo-Keto Reductase 1C3 is produced by our E.coli expression system and the target gene encoding Met1-Tyr323 is expressed. |
| Names | Aldo-Keto Reductase Family 1 Member C2, 3-Alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-Binding Protein, DD/BABP, Trans-1,2-Dihydrobenzene-1,2-Diol Dehydrogenase, Type III 3-Alpha-Hydroxysteroid Dehydrogenase, AKR1C2, DDH2 |
| Accession # | P52895 |
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0. |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAI RSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIP KDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHP YFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ LQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
|
| Background | Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) plays a role in concert with the 5-α/5-β-Steroid Reductases to convert Steroid hormones into the 3-α/5-α and 3-α/5-β-Tetrahydrosteroids. AKR1C2 catalyzes the inactivation of the most potent androgen 5-α-Dihydrotestosterone (5-α-DHT) to 5-α-Androstane-3-α, 17-β-diol (3-α-diol). |












