| ELISA kit |
| Clinical diagnosis |
| Trfia |
| ANTIBODIES |
| CLIA kits |
| Proteins |
| New Products |
| > Human |
| > Canine |
| > Bovine |
| > Equine |
| > Fish |
| > Mouse |
| > Rat |
| > Chicken |
| > Porcine |
| > Rabbit |
| > Goat |
| > Simian |
| > General |
| > Cavia |
| > Caprine |
| > Sheep |
| > Cattle |
Recombinant Mouse Interleukin-12/IL-12
Instruction Manual!
| Product name: | Recombinant Mouse Interleukin-12/IL-12 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
SourceHuman CellsDescriptionRecombinant Mouse Interleukin-12 is produced by our Mammalian expression system and the target gene encoding Met23-Ser335&Arg23-Ala215 is expressed.NamesIL-12, Interleukin 12, Interleukin-12 subunit alpha,IL-12A,Cytotoxic lymphocyte maturation factor 35 kDa subunit,CLMF p35,IL-12 subunit p35,NK cellAccession #P43432 & NP032377FormulationLyophilized from a 0.2 μm filtered solution of PBS, pH7.4.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQ YTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFN IKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNK YENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMK ETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS&RVIPVSGPARC LSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRET SSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELM QSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
BackgroundIL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN-γ) and tumor necrosis factor-alpha (TNF-α) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN-γ. T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity. IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes.
