Recombinant Human C-X-C Motif Chemokine 5/CXCL5
Product name: | Recombinant Human C-X-C Motif Chemokine 5/CXCL5 |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 6.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Human C-X-C Motif Chemokine 5 is produced by our E.coli expression system and the target gene encoding Leu44-Asn114 is expressed. |
Names | C-X-C Motif Chemokine 5, ENA-78 (1-78), Epithelial-Derived Neutrophil-Activating Protein 78, Neutrophil-Activating Peptide ENA-78, Small-Inducible Cytokine B5, ENA-78 (8-78), ENA-78 (9-78), CXCL5, ENA78, SCYB5 |
Accession # | P42830 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 6.0. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKIL DGGNKEN
|
Background | C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78). In vitro, ENA-78(8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers. |